RBM38 Antikörper (N-Term)

Produktnummer ABIN633487

Produktdetails anti-RBM38 Antikörper

Target: RBM38 (RNA Binding Motif Protein 38 (RBM38))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBM38 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB)

Spezifität: RBM38 antibody was raised against the N terminal of RBM38

Aufreinigung: Affinity purified

Immunogen: RBM38 antibody was raised using the N terminal of RBM38 corresponding to a region with amino acids LPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAER

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBM38 Blocking Peptide, catalog no. 33R-5295, is also available for use as a blocking control in assays to test for specificity of this RBM38 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM38 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBM38

Target: RBM38 (RNA Binding Motif Protein 38 (RBM38))

Andere Bezeichnung: RBM38 (RBM38 Produkte)

Synonyme: rnpc1 antikoerper, seb4b antikoerper, seb4d antikoerper, XSeb4R antikoerper, MGC89204 antikoerper, hsrnaseb antikoerper, YF-55 antikoerper, fi25e12 antikoerper, wu:fi25e12 antikoerper, zgc:92336 antikoerper, xseb4r antikoerper, HSRNASEB antikoerper, RNPC1 antikoerper, SEB4B antikoerper, SEB4D antikoerper, dJ800J21.2 antikoerper, Rnpc1 antikoerper, Seb4 antikoerper, Seb4l antikoerper, RNA binding motif protein 38 antikoerper, RNA binding motif protein 38 L homeolog antikoerper, rbm38 antikoerper, rbm38.L antikoerper, RBM38 antikoerper, Rbm38 antikoerper

Hintergrund: RBM38 is a probable RNA-binding protein.

Molekulargewicht: 26 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development