ADAD2 Antikörper (C-Term)

Produktnummer ABIN633494

Produktdetails anti-ADAD2 Antikörper

Target: ADAD2 (Adenosine Deaminase Domain Containing 2 (ADAD2))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADAD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ADAD2 antibody was raised against the C terminal of ADAD2

Aufreinigung: Affinity purified

Immunogen: ADAD2 antibody was raised using the C terminal of ADAD2 corresponding to a region with amino acids TPDTCRGLSLNWSLGDPGIEVVDVATGRVKANAALGPPSRLCKASFLRAF

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADAD2 Blocking Peptide, catalog no. 33R-9218, is also available for use as a blocking control in assays to test for specificity of this ADAD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADAD2

Target: ADAD2 (Adenosine Deaminase Domain Containing 2 (ADAD2))

Andere Bezeichnung: ADAD2 (ADAD2 Produkte)

Synonyme: tenrl antikoerper, MGC145701 antikoerper, TENRL antikoerper, 4930403J07Rik antikoerper, RGD1560949 antikoerper, adenosine deaminase domain containing 2 antikoerper, adenosine deaminase domain containing 2 S homeolog antikoerper, ADAD2 antikoerper, adad2 antikoerper, adad2.S antikoerper, Adad2 antikoerper

Hintergrund: ADAD2 belongs to the ADAD family, and contains 1 A to I editase domain and 1 DRBM (double-stranded RNA-binding) domain. The exact functions of ADAD2 remain unknown.

Molekulargewicht: 71 kDa (MW of target protein)