APOBEC3F Antikörper (C-Term)
-
- Target Alle APOBEC3F Antikörper anzeigen
- APOBEC3F (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3F (APOBEC3F))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser APOBEC3F Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ApoBEC3 F antibody was raised against the C terminal of APOBEC3
- Aufreinigung
- Affinity purified
- Immunogen
- ApoBEC3 F antibody was raised using the C terminal of APOBEC3 corresponding to a region with amino acids ASVEIMGYKDFKYCWENFVYNDDEPFKPWKGLKYNFLFLDSKLQEILE
- Top Product
- Discover our top product APOBEC3F Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ApoBEC3F Blocking Peptide, catalog no. 33R-1538, is also available for use as a blocking control in assays to test for specificity of this ApoBEC3F antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APOBEC3F (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3F (APOBEC3F))
- Andere Bezeichnung
- ApoBEC3F (APOBEC3F Produkte)
- Hintergrund
- APOBEC3F is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Molekulargewicht
- 45 kDa (MW of target protein)
-