APOBEC3F Antikörper (C-Term)

Produktnummer ABIN633498

Produktdetails anti-APOBEC3F Antikörper

Target: APOBEC3F (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3F (APOBEC3F))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser APOBEC3F Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ApoBEC3 F antibody was raised against the C terminal of APOBEC3

Aufreinigung: Affinity purified

Immunogen: ApoBEC3 F antibody was raised using the C terminal of APOBEC3 corresponding to a region with amino acids ASVEIMGYKDFKYCWENFVYNDDEPFKPWKGLKYNFLFLDSKLQEILE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ApoBEC3F Blocking Peptide, catalog no. 33R-1538, is also available for use as a blocking control in assays to test for specificity of this ApoBEC3F antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu APOBEC3F

Target: APOBEC3F (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3F (APOBEC3F))

Andere Bezeichnung: ApoBEC3F (APOBEC3F Produkte)

Synonyme: A3F antikoerper, ARP8 antikoerper, BK150C2.4.MRNA antikoerper, KA6 antikoerper, APOBEC3F antikoerper, apolipoprotein B mRNA editing enzyme catalytic subunit 3F antikoerper, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F antikoerper, APOBEC3F antikoerper

Hintergrund: APOBEC3F is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been identified.

Molekulargewicht: 45 kDa (MW of target protein)