APOBEC2 Antikörper (Middle Region)
-
- Target Alle APOBEC2 Antikörper anzeigen
- APOBEC2 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 2 (APOBEC2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser APOBEC2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ApoBEC2 antibody was raised against the middle region of APOBEC2
- Aufreinigung
- Affinity purified
- Immunogen
- ApoBEC2 antibody was raised using the middle region of APOBEC2 corresponding to a region with amino acids CKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADIL
- Top Product
- Discover our top product APOBEC2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ApoBEC2 Blocking Peptide, catalog no. 33R-1724, is also available for use as a blocking control in assays to test for specificity of this ApoBEC2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APOBEC2 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 2 (APOBEC2))
- Andere Bezeichnung
- ApoBEC2 (APOBEC2 Produkte)
- Synonyme
- MGC84761 antikoerper, arp1 antikoerper, arcd1 antikoerper, MGC89256 antikoerper, APOBEC2 antikoerper, DKFZp468H1727 antikoerper, Arp1 antikoerper, ARCD1 antikoerper, ARP1 antikoerper, apolipoprotein B mRNA editing enzyme catalytic subunit 2 antikoerper, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2 L homeolog antikoerper, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2 antikoerper, apolipoprotein B mRNA editing enzyme, catalytic polypeptide 2 antikoerper, APOBEC2 antikoerper, apobec2.L antikoerper, apobec2 antikoerper, Apobec2 antikoerper
- Hintergrund
- APOBEC2 belongs to the cytidine and deoxycytidylate deaminase family. It is probable C to U editing enzyme whose physiological substrate is not yet known. It does not display detectable apoB mRNA editing and has a low intrinsic cytidine deaminase activity.
- Molekulargewicht
- 26 kDa (MW of target protein)
-