RPLP0 Antikörper (N-Term)

Produktnummer ABIN633509

Produktdetails anti-RPLP0 Antikörper

Target: RPLP0 (Ribosomal Protein, Large, P0 (RPLP0))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPLP0 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RPLP0 antibody was raised against the N terminal of RPLP0

Aufreinigung: Affinity purified

Immunogen: RPLP0 antibody was raised using the N terminal of RPLP0 corresponding to a region with amino acids TEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITT

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPLP0 Blocking Peptide, catalog no. 33R-9044, is also available for use as a blocking control in assays to test for specificity of this RPLP0 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPLP0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPLP0

Target: RPLP0 (Ribosomal Protein, Large, P0 (RPLP0))

Andere Bezeichnung: RPLP0 (RPLP0 Produkte)

Synonyme: AP3 antikoerper, Ap3 antikoerper, Ape antikoerper, CG7490 antikoerper, Dmel\\CG7490 antikoerper, LP0 antikoerper, P0 antikoerper, P35 antikoerper, PO antikoerper, RLA0 antikoerper, RPL P0 antikoerper, RpP0 antikoerper, RpPO antikoerper, Rplp0 antikoerper, l(3)0154 antikoerper, l(3)01544 antikoerper, p0 antikoerper, RPLP0 antikoerper, arp antikoerper, fa56b12 antikoerper, fb04a12 antikoerper, wu:fa56b12 antikoerper, wu:fb15a08 antikoerper, wu:fk48c12 antikoerper, arbp antikoerper, l10e antikoerper, lp0 antikoerper, prlp0 antikoerper, rpp0 antikoerper, L10E antikoerper, PRLP0 antikoerper, RPP0 antikoerper, 36B4 antikoerper, Arbp antikoerper, ARBP antikoerper, Ribosomal protein LP0 antikoerper, ribosomal protein lateral stalk subunit P0 antikoerper, ribosomal protein, large, P0 antikoerper, ribosomal protein, large, P0 S homeolog antikoerper, RpLP0 antikoerper, RPLP0 antikoerper, rplp0 antikoerper, rplp0.S antikoerper, Rplp0 antikoerper

Hintergrund: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. The ribosomal protein is a component of the 60S subunit. The protein, which is the functional equivalent of the E. coli L10 ribosomal protein, belongs to the L10P family of ribosomal proteins.

Molekulargewicht: 34 kDa (MW of target protein)