PABPC1L2A Antikörper
-
- Target Alle PABPC1L2A Produkte
- PABPC1L2A (Poly(A) Binding Protein, Cytoplasmic 1-Like 2A (PABPC1L2A))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PABPC1L2A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PABPC1 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEEDTDEEATL
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PABPC1L2A Blocking Peptide, catalog no. 33R-6710, is also available for use as a blocking control in assays to test for specificity of this PABPC1L2A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PABPC0 0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PABPC1L2A (Poly(A) Binding Protein, Cytoplasmic 1-Like 2A (PABPC1L2A))
- Andere Bezeichnung
- PABPC1L2A (PABPC1L2A Produkte)
- Hintergrund
- PABPC1L2A may be involved in nucleic acid and nucleotide binding
- Molekulargewicht
- 23 kDa (MW of target protein)
-