PABPC1L2A Antikörper

Produktnummer ABIN633510

Produktdetails anti-PABPC1L2A Antikörper

Target: PABPC1L2A (Poly(A) Binding Protein, Cytoplasmic 1-Like 2A (PABPC1L2A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PABPC1L2A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PABPC1 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEEDTDEEATL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PABPC1L2A Blocking Peptide, catalog no. 33R-6710, is also available for use as a blocking control in assays to test for specificity of this PABPC1L2A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PABPC0 0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PABPC1L2A

Target: PABPC1L2A (Poly(A) Binding Protein, Cytoplasmic 1-Like 2A (PABPC1L2A))

Andere Bezeichnung: PABPC1L2A (PABPC1L2A Produkte)

Synonyme: RBM32A antikoerper, poly(A) binding protein cytoplasmic 1 like 2A antikoerper, PABPC1L2A antikoerper

Hintergrund: PABPC1L2A may be involved in nucleic acid and nucleotide binding

Molekulargewicht: 23 kDa (MW of target protein)