Synaptojanin 2 Antikörper (N-Term)
-
- Target Alle Synaptojanin 2 (SYNJ2) Antikörper anzeigen
- Synaptojanin 2 (SYNJ2)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Synaptojanin 2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Synaptojanin 2 antibody was raised against the N terminal of SYNJ2
- Aufreinigung
- Affinity purified
- Immunogen
- Synaptojanin 2 antibody was raised using the N terminal of SYNJ2 corresponding to a region with amino acids SGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIAL
- Top Product
- Discover our top product SYNJ2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Synaptojanin 2 Blocking Peptide, catalog no. 33R-8466, is also available for use as a blocking control in assays to test for specificity of this Synaptojanin 2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYNJ2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Synaptojanin 2 (SYNJ2)
- Andere Bezeichnung
- Synaptojanin 2 (SYNJ2 Produkte)
- Synonyme
- SYNJ2 antikoerper, INPP5H antikoerper, AI481647 antikoerper, SJ2 antikoerper, mKIAA0348 antikoerper, synaptojanin 2 antikoerper, synaptojanin-2 antikoerper, SYNJ2 antikoerper, LOC100074269 antikoerper, synj2 antikoerper, Synj2 antikoerper
- Hintergrund
- SYNJ2 may play a role in allowing polymerase epsilon to carry out its replication and/or repair function.
- Molekulargewicht
- 165 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-