NSF Antikörper (C-Term)

Produktnummer ABIN633516

Produktdetails anti-NSF Antikörper

Target: NSF (N-Ethylmaleimide-Sensitive Factor (NSF))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NSF Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NSF antibody was raised against the C terminal of NSF

Aufreinigung: Affinity purified

Immunogen: NSF antibody was raised using the C terminal of NSF corresponding to a region with amino acids STTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLL

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NSF Blocking Peptide, catalog no. 33R-8893, is also available for use as a blocking control in assays to test for specificity of this NSF antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSF antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NSF

Target: NSF (N-Ethylmaleimide-Sensitive Factor (NSF))

Andere Bezeichnung: NSF (NSF Produkte)

Synonyme: SKD2 antikoerper, AI316878 antikoerper, AU020090 antikoerper, AU067812 antikoerper, NSF antikoerper, 18.m06598 antikoerper, nsf antikoerper, si:bz18k17.1 antikoerper, wu:fj33g11 antikoerper, N-ethylmaleimide sensitive factor antikoerper, T1J1.4 antikoerper, T1J1_4 antikoerper, NEM-sensitive fusion protein antikoerper, N-ethylmaleimide sensitive factor, vesicle fusing ATPase antikoerper, N-ethylmaleimide sensitive fusion protein antikoerper, N-ethylmaleimide-sensitive factor antikoerper, N-ethylmaleimide sensitive factor antikoerper, N-ethylmaleimide-sensitive fusion protein, putative antikoerper, N-ethylmaleimide sensitive factor L homeolog antikoerper, vesicle-fusing ATPase antikoerper, N-ethylmaleimide-sensitive factor a antikoerper, AAA-type ATPase family protein antikoerper, NSF antikoerper, Nsf antikoerper, nsf antikoerper, BBOV_II007200 antikoerper, TGME49_318510 antikoerper, nsf.L antikoerper, LOC100180685 antikoerper, LOC9310886 antikoerper, nsfa antikoerper

Hintergrund: NSF is required for vesicle-mediated transport. NSF catalyzes the fusion of transport vesicles within the Golgi cisternae. It is s also required for transport from the endoplasmic reticulum to the Golgi stack. NSF seems to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin.

Molekulargewicht: 33 kDa (MW of target protein)