NSF Antikörper (C-Term)
-
- Target Alle NSF Antikörper anzeigen
- NSF (N-Ethylmaleimide-Sensitive Factor (NSF))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NSF Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NSF antibody was raised against the C terminal of NSF
- Aufreinigung
- Affinity purified
- Immunogen
- NSF antibody was raised using the C terminal of NSF corresponding to a region with amino acids STTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLL
- Top Product
- Discover our top product NSF Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NSF Blocking Peptide, catalog no. 33R-8893, is also available for use as a blocking control in assays to test for specificity of this NSF antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSF antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NSF (N-Ethylmaleimide-Sensitive Factor (NSF))
- Andere Bezeichnung
- NSF (NSF Produkte)
- Hintergrund
- NSF is required for vesicle-mediated transport. NSF catalyzes the fusion of transport vesicles within the Golgi cisternae. It is s also required for transport from the endoplasmic reticulum to the Golgi stack. NSF seems to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin.
- Molekulargewicht
- 33 kDa (MW of target protein)
-