CNOT6 Antikörper (N-Term)

Produktnummer ABIN633523

Produktdetails anti-CNOT6 Antikörper

Target: CNOT6 (CCR4-NOT Transcription Complex, Subunit 6 (CNOT6))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CNOT6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CNOT6 antibody was raised against the N terminal of CNOT6

Aufreinigung: Affinity purified

Immunogen: CNOT6 antibody was raised using the N terminal of CNOT6 corresponding to a region with amino acids EISGKVRSLSASLWSLTHLTALHLSDNSLSRIPSDIAKLHNLVYLDLSSN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CNOT6 Blocking Peptide, catalog no. 33R-2486, is also available for use as a blocking control in assays to test for specificity of this CNOT6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNOT6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CNOT6

Target: CNOT6 (CCR4-NOT Transcription Complex, Subunit 6 (CNOT6))

Andere Bezeichnung: CNOT6 (CNOT6 Produkte)

Hintergrund: CNOT6 is a subunit of the CCR4-NOT core transcriptional regulation complex. CNOT6 has a 3'-5' RNase activity and prefers polyadenylated substates.

Molekulargewicht: 63 kDa (MW of target protein)