CNOT6 Antikörper (N-Term)
-
- Target Alle CNOT6 Antikörper anzeigen
- CNOT6 (CCR4-NOT Transcription Complex, Subunit 6 (CNOT6))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CNOT6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CNOT6 antibody was raised against the N terminal of CNOT6
- Aufreinigung
- Affinity purified
- Immunogen
- CNOT6 antibody was raised using the N terminal of CNOT6 corresponding to a region with amino acids EISGKVRSLSASLWSLTHLTALHLSDNSLSRIPSDIAKLHNLVYLDLSSN
- Top Product
- Discover our top product CNOT6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CNOT6 Blocking Peptide, catalog no. 33R-2486, is also available for use as a blocking control in assays to test for specificity of this CNOT6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNOT6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CNOT6 (CCR4-NOT Transcription Complex, Subunit 6 (CNOT6))
- Andere Bezeichnung
- CNOT6 (CNOT6 Produkte)
- Synonyme
- CCR4 antikoerper, A230103N10Rik antikoerper, AA407540 antikoerper, AW456442 antikoerper, RGD1310783 antikoerper, wu:fa03c11 antikoerper, wu:fc17f01 antikoerper, zgc:65822 antikoerper, CCR4-NOT transcription complex subunit 6 antikoerper, CCR4-NOT transcription complex, subunit 6 antikoerper, CCR4-NOT transcription complex, subunit 6a antikoerper, CNOT6 antikoerper, Cnot6 antikoerper, cnot6a antikoerper, cnot6 antikoerper
- Hintergrund
- CNOT6 is a subunit of the CCR4-NOT core transcriptional regulation complex. CNOT6 has a 3'-5' RNase activity and prefers polyadenylated substates.
- Molekulargewicht
- 63 kDa (MW of target protein)
-