NIP7 Antikörper
-
- Target Alle NIP7 Antikörper anzeigen
- NIP7 (Nuclear Import 7 Homolog (NIP7))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NIP7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- NIP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKST
- Top Product
- Discover our top product NIP7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NIP7 Blocking Peptide, catalog no. 33R-7091, is also available for use as a blocking control in assays to test for specificity of this NIP7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NIP7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NIP7 (Nuclear Import 7 Homolog (NIP7))
- Andere Bezeichnung
- NIP7 (NIP7 Produkte)
- Synonyme
- HSPC031 antikoerper, KD93 antikoerper, CGI-37 antikoerper, Nip7p antikoerper, pEachy antikoerper, zgc:110384 antikoerper, nip7 antikoerper, Nip7 antikoerper, ACYPI003208 antikoerper, NIP7 antikoerper, DKFZp468F182 antikoerper, 1110017C15Rik antikoerper, 6330509M23Rik antikoerper, AA408773 antikoerper, AA410017 antikoerper, PEachy antikoerper, NIP7, nucleolar pre-rRNA processing protein antikoerper, NIP7, nucleolar pre-rRNA processing protein L homeolog antikoerper, 60S ribosome subunit biogenesis protein NIP7 homolog antikoerper, NIP7 antikoerper, Nip7 antikoerper, nip7.L antikoerper, nip7 antikoerper
- Hintergrund
- NIP7 contains 1PUA domain and belongs to the NIP7 family. It may play a role in 60S ribosomal subunit synthesis.
- Molekulargewicht
- 20 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-