CDKN2AIP Antikörper (N-Term)
-
- Target Alle CDKN2AIP Antikörper anzeigen
- CDKN2AIP (CDKN2A Interacting Protein (CDKN2AIP))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CDKN2AIP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CDKN2 AIP antibody was raised against the N terminal of CDKN2 IP
- Aufreinigung
- Affinity purified
- Immunogen
- CDKN2 AIP antibody was raised using the N terminal of CDKN2 IP corresponding to a region with amino acids RRDFLLRNAGDLAPAGGAASASTDEAADAESGTRNRQLQQLISFSMAWAN
- Top Product
- Discover our top product CDKN2AIP Primärantikörper
-
anti-CDKN2A Interacting Protein (CDKN2AIP) (AA 1-579) antibody
CDKN2AIP Reaktivität: Human WB, ELISA, IF, IHC (p) Wirt: Maus Monoclonal 1A6 unconjugated
anti-CDKN2A Interacting Protein (CDKN2AIP) (AA 1-579) antibodyCDKN2AIP Reaktivität: Human WB, ELISA, RNAi Wirt: Maus Monoclonal 1F7 unconjugated
anti-CDKN2A Interacting Protein (CDKN2AIP) (Internal Region) antibodyCDKN2AIP Reaktivität: Human, Maus WB, ELISA, IHC, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-CDKN2A Interacting Protein (CDKN2AIP) (AA 1-579) antibodyCDKN2AIP Reaktivität: Human WB, IHC (p) Wirt: Maus Polyclonal unconjugated
anti-CDKN2A Interacting Protein (CDKN2AIP) (AA 1-579) antibodyCDKN2AIP Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-CDKN2A Interacting Protein (CDKN2AIP) (AA 1-579) antibodyCDKN2AIP Reaktivität: Human WB, ELISA, IP Wirt: Maus Monoclonal 4D11 unconjugated
anti-CDKN2A Interacting Protein (CDKN2AIP) (AA 1-220) antibodyCDKN2AIP Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-CDKN2A Interacting Protein (CDKN2AIP) (AA 470-519) antibodyCDKN2AIP Reaktivität: Human, Maus, Ratte, Hund, Kaninchen, Rind (Kuh), Schwein, Meerschweinchen, Affe WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-CDKN2A Interacting Protein (CDKN2AIP) (C-Term) antibodyCDKN2AIP Reaktivität: Human, Maus, Ratte, Hund WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-CDKN2A Interacting Protein (CDKN2AIP) (C-Term) antibodyCDKN2AIP Reaktivität: Human, Maus, Ratte, Hund, Kaninchen, Rind (Kuh), Meerschweinchen, Pferd WB, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CDKN2AIP Blocking Peptide, catalog no. 33R-8130, is also available for use as a blocking control in assays to test for specificity of this CDKN2AIP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDKN0 IP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CDKN2AIP (CDKN2A Interacting Protein (CDKN2AIP))
- Andere Bezeichnung
- CDKN2AIP (CDKN2AIP Produkte)
- Synonyme
- CARF antikoerper, 4921511I16Rik antikoerper, AW208986 antikoerper, CDKN2AIP antikoerper, RGD1305302 antikoerper, CDKN2A interacting protein antikoerper, CDKN2A interacting protein L homeolog antikoerper, CDKN2AIP antikoerper, Cdkn2aip antikoerper, cdkn2aip antikoerper, cdkn2aip.L antikoerper
- Hintergrund
- The CDKN2AIP protein activates TP53/p53 by CDKN2A-dependent and CDKN2A-independent pathways.
- Molekulargewicht
- 61 kDa (MW of target protein)
-
