C19orf24 Antikörper (N-Term)

Produktnummer ABIN633528

Produktdetails anti-C19orf24 Antikörper

Target: C19orf24 (Chromosome 19 Open Reading Frame 24 (C19orf24))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C19orf24 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C19 ORF24 antibody was raised against the N terminal Of C19 rf24

Aufreinigung: Affinity purified

Immunogen: C19 ORF24 antibody was raised using the N terminal Of C19 rf24 corresponding to a region with amino acids MREGQEMGPTPVPSNPLLHRSFPCWPRGWSHPVPTRELLLEPAQPADLLP

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C19ORF24 Blocking Peptide, catalog no. 33R-6357, is also available for use as a blocking control in assays to test for specificity of this C19ORF24 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF24 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C19orf24

Target: C19orf24 (Chromosome 19 Open Reading Frame 24 (C19orf24))

Andere Bezeichnung: C19ORF24 (C19orf24 Produkte)

Synonyme: chromosome 19 open reading frame 24 antikoerper, C19orf24 antikoerper, c19orf24 antikoerper

Hintergrund: C19orf24 is a novel human non-classical secreted protein which is encoded by the hypothetical gene C19orf24 (chromosome 19 open reading frame 24). The exact function of C19orf24 remains unknown.

Molekulargewicht: 14 kDa (MW of target protein)