RBM47 Antikörper (Middle Region)
-
- Target Alle RBM47 Produkte
- RBM47 (RNA Binding Motif Protein 47 (RBM47))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RBM47 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RBM47 antibody was raised against the middle region of RBM47
- Aufreinigung
- Affinity purified
- Immunogen
- RBM47 antibody was raised using the middle region of RBM47 corresponding to a region with amino acids HFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGA
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RBM47 Blocking Peptide, catalog no. 33R-3730, is also available for use as a blocking control in assays to test for specificity of this RBM47 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM47 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RBM47 (RNA Binding Motif Protein 47 (RBM47))
- Andere Bezeichnung
- RBM47 (RBM47 Produkte)
- Hintergrund
- RBM47 may be involved in RNA binding and nucleotide binding.
- Molekulargewicht
- 57 kDa (MW of target protein)
-