Splicing Factor 4 Antikörper (N-Term)

Produktnummer ABIN633534

Produktdetails anti-Splicing Factor 4 Antikörper

Target: Splicing Factor 4 (SF4)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Splicing Factor 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SF4 antibody was raised against the N terminal of SF4

Aufreinigung: Affinity purified

Immunogen: SF4 antibody was raised using the N terminal of SF4 corresponding to a region with amino acids MSLKMDNRDVAGKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKM

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SF4 Blocking Peptide, catalog no. 33R-6459, is also available for use as a blocking control in assays to test for specificity of this SF4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Splicing Factor 4

Target: Splicing Factor 4 (SF4)

Andere Bezeichnung: SF4 (SF4 Produkte)

Synonyme: SF4 antikoerper, rbp antikoerper, f23858 antikoerper, F23858 antikoerper, RBP antikoerper, 5730496N02Rik antikoerper, Sf4 antikoerper, sf4 antikoerper, SURP and G-patch domain containing 1 antikoerper, SURP and G patch domain containing 1 antikoerper, SURP and G-patch domain containing 1 S homeolog antikoerper, SUGP1 antikoerper, sugp1 antikoerper, Sugp1 antikoerper, sugp1.S antikoerper

Hintergrund: SF4 is a member of the SURP family of splicing factors.SF4 is a member of the SURP family of splicing factors.

Molekulargewicht: 72 kDa (MW of target protein)