NOC4L Antikörper

Produktnummer ABIN633538

Produktdetails anti-NOC4L Antikörper

Target: NOC4L (Nucleolar Complex Associated 4 Homolog (NOC4L))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NOC4L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Affinity purified

Immunogen: NOC4 L antibody was raised using a synthetic peptide corresponding to a region with amino acids CRVLVHRPHGPELDADPYDPGEEDPAQSRALESSLWELQALQRHYHPEVS

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NOC4L Blocking Peptide, catalog no. 33R-1802, is also available for use as a blocking control in assays to test for specificity of this NOC4L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOC0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NOC4L

Target: NOC4L (Nucleolar Complex Associated 4 Homolog (NOC4L))

Andere Bezeichnung: NOC4L (NOC4L Produkte)

Synonyme: NET49 antikoerper, NOC4 antikoerper, UTP19 antikoerper, NOC4L antikoerper, AI326906 antikoerper, RGD1310661 antikoerper, net49 antikoerper, noc4 antikoerper, noc4lb antikoerper, noc4la antikoerper, NOC4 protein homolog antikoerper, sb:cb534 antikoerper, wu:fb78g04 antikoerper, zgc:110429 antikoerper, nucleolar complex associated 4 homolog antikoerper, NOC4 like antikoerper, nucleolar complex associated 4 homolog S homeolog antikoerper, nucleolar complex associated 4 homolog L homeolog antikoerper, NOC4L antikoerper, Noc4l antikoerper, noc4l.S antikoerper, noc4l.L antikoerper, noc4l antikoerper

Hintergrund: NOC4L plays a specific role in biogenesis of 40 S subunit of ribosome.

Molekulargewicht: 57 kDa (MW of target protein)