RBM42 Antikörper (C-Term)

Produktnummer ABIN633539

Produktdetails anti-RBM42 Antikörper

Target: RBM42 (RNA Binding Motif Protein 42 (RBM42))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBM42 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RBM42 antibody was raised against the C terminal of RBM42

Aufreinigung: Affinity purified

Immunogen: RBM42 antibody was raised using the C terminal of RBM42 corresponding to a region with amino acids DPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVVRKKQKEKKKLGLR

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBM42 Blocking Peptide, catalog no. 33R-2115, is also available for use as a blocking control in assays to test for specificity of this RBM42 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM42 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBM42

Target: RBM42 (RNA Binding Motif Protein 42 (RBM42))

Andere Bezeichnung: RBM42 (RBM42 Produkte)

Synonyme: rbm42b antikoerper, MGC10433l antikoerper, zgc:109907 antikoerper, rbm42 antikoerper, rbm42a antikoerper, 1700003D06Rik antikoerper, 3100004P22Rik antikoerper, RGD1306184 antikoerper, RNA binding motif protein 42 L homeolog antikoerper, RNA binding motif protein 42 antikoerper, RNA binding motif protein 42 S homeolog antikoerper, rbm42.L antikoerper, RBM42 antikoerper, rbm42 antikoerper, rbm42.S antikoerper, Rbm42 antikoerper

Hintergrund: RBM42 belongs to the RRM RBM42 family and it contains 1 RRM (RNA recognition motif) domain. The functions of RBM42 remain unknown.

Molekulargewicht: 50 kDa (MW of target protein)