ESRP2 Antikörper (N-Term)
-
- Target Alle ESRP2 Antikörper anzeigen
- ESRP2 (Epithelial Splicing Regulatory Protein 2 (ESRP2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ESRP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RBM35 B antibody was raised against the N terminal of RBM35
- Aufreinigung
- Affinity purified
- Immunogen
- RBM35 B antibody was raised using the N terminal of RBM35 corresponding to a region with amino acids ATAGALGRDLGSDETDLILLVWQVVEPRSRQVGTLHKSLVRAEAAALSTQ
- Top Product
- Discover our top product ESRP2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RBM35B Blocking Peptide, catalog no. 33R-1548, is also available for use as a blocking control in assays to test for specificity of this RBM35B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM30 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ESRP2 (Epithelial Splicing Regulatory Protein 2 (ESRP2))
- Andere Bezeichnung
- RBM35B (ESRP2 Produkte)
- Hintergrund
- RBM35B contains 3 RRM (RNA recognition motif) domains. ESRP1 and ESRP2 (RBM35B) are epithelial cell-type-specific regulators of FGFR2 splicing.
- Molekulargewicht
- 77 kDa (MW of target protein)
-