RPF1 Antikörper (N-Term)

Produktnummer ABIN633541

Produktdetails anti-RPF1 Antikörper

Target: RPF1 (Brix Domain Containing 5 (RPF1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BXDC5 antibody was raised against the N terminal of BXDC5

Aufreinigung: Affinity purified

Immunogen: BXDC5 antibody was raised using the N terminal of BXDC5 corresponding to a region with amino acids AAAFPPGFSISEIKNKQRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGD

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BXDC5 Blocking Peptide, catalog no. 33R-1004, is also available for use as a blocking control in assays to test for specificity of this BXDC5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BXDC5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPF1

Target: RPF1 (Brix Domain Containing 5 (RPF1))

Andere Bezeichnung: BXDC5 (RPF1 Produkte)

Synonyme: bxdc5 antikoerper, zgc:86604 antikoerper, MGC86358 antikoerper, BXDC5 antikoerper, MGC145697 antikoerper, RP11-118B23.1 antikoerper, 2210420E24Rik antikoerper, 2310066N05Rik antikoerper, Bxdc5 antikoerper, rpf1 antikoerper, ribosome production factor 1 homolog antikoerper, ribosome production factor 1 homolog L homeolog antikoerper, RNA processing factor 1 antikoerper, rpf1 antikoerper, RPF1 antikoerper, rpf1.L antikoerper, Rpf1 antikoerper, bxdc5 antikoerper

Hintergrund: BXDC5 may be required for ribosome biogenesis.

Molekulargewicht: 38 kDa (MW of target protein)