C7orf64 Antikörper (C-Term)

Produktnummer ABIN633543

Produktdetails anti-C7orf64 Antikörper

Target: C7orf64 (Chromosome 7 Open Reading Frame 64 (C7orf64))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C7orf64 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DKFZP564 O0523 antibody was raised against the C terminal of DKFZP564 0523

Aufreinigung: Affinity purified

Immunogen: DKFZP564 O0523 antibody was raised using the C terminal of DKFZP564 0523 corresponding to a region with amino acids FLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHKLKEVISSVPK

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DKFZP564O0523 Blocking Peptide, catalog no. 33R-2980, is also available for use as a blocking control in assays to test for specificity of this DKFZP564O0523 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DKFZP560 0523 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C7orf64

Target: C7orf64 (Chromosome 7 Open Reading Frame 64 (C7orf64))

Andere Bezeichnung: DKFZP564O0523 (C7orf64 Produkte)

Synonyme: C7orf64 antikoerper, DKFZP564O0523 antikoerper, HSPC304 antikoerper, RGD1310794 antikoerper, AW548102 antikoerper, C030048B08Rik antikoerper, dkfzp564o0523 antikoerper, C4H7orf64 antikoerper, RNA binding motif protein 48 antikoerper, rbm48 antikoerper, RBM48 antikoerper, Rbm48 antikoerper

Hintergrund: The function of DKFZP564O0523 has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 42 kDa (MW of target protein)