RG9MTD3 Antikörper

Produktnummer ABIN633548

Produktdetails anti-RG9MTD3 Antikörper

Target: RG9MTD3 (RNA (Guanine-9-) Methyltransferase Domain Containing 3 (RG9MTD3))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RG9MTD3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: RG9 MTD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HALEDVDLNKVYILGGLVDESIQKKVTFQKAREYSVKTARLPIQEYMVRN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RG9MTD3 Blocking Peptide, catalog no. 33R-3692, is also available for use as a blocking control in assays to test for specificity of this RG9MTD3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RG0 TD3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RG9MTD3

Target: RG9MTD3 (RNA (Guanine-9-) Methyltransferase Domain Containing 3 (RG9MTD3))

Andere Bezeichnung: RG9MTD3 (RG9MTD3 Produkte)

Synonyme: RG9MTD3 antikoerper, RP11-3J10.9 antikoerper, bA3J10.9 antikoerper, Rg9mtd3 antikoerper, 2610042J10Rik antikoerper, Rnmtd3 antikoerper, tRNA methyltransferase 10B antikoerper, TRMT10B antikoerper, Trmt10b antikoerper

Hintergrund: RG9MTD3 belongs to the RNA methyltransferase trmD family, TRM10 subfamily. It is a probable RNA methyltransferase.

Molekulargewicht: 36 kDa (MW of target protein)