RPUSD2 Antikörper (C-Term)
-
- Target Alle RPUSD2 Produkte
- RPUSD2 (RNA Pseudouridylate Synthase Domain Containing 2 (RPUSD2))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RPUSD2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RPUSD2 antibody was raised against the C terminal of RPUSD2
- Aufreinigung
- Affinity purified
- Immunogen
- RPUSD2 antibody was raised using the C terminal of RPUSD2 corresponding to a region with amino acids AEHQAKQSLDVLDLCEGDLSPGLTDSTAPSSELGKDDLEELAAAAQKMEE
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RPUSD2 Blocking Peptide, catalog no. 33R-1132, is also available for use as a blocking control in assays to test for specificity of this RPUSD2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPUSD2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPUSD2 (RNA Pseudouridylate Synthase Domain Containing 2 (RPUSD2))
- Andere Bezeichnung
- RPUSD2 (RPUSD2 Produkte)
- Synonyme
- RPUSD2 antikoerper, C15orf19 antikoerper, C18B11 antikoerper, 4921503C21Rik antikoerper, 9630001E10 antikoerper, BB231107 antikoerper, RGD1306147 antikoerper, RNA pseudouridylate synthase domain containing 2 antikoerper, RPUSD2 antikoerper, Rpusd2 antikoerper
- Hintergrund
- RPUSD2 is involved in RNA binding and nucleotide binding.
- Molekulargewicht
- 61 kDa (MW of target protein)
-