RPUSD2 Antikörper (C-Term)

Produktnummer ABIN633550

Produktdetails anti-RPUSD2 Antikörper

Target: RPUSD2 (RNA Pseudouridylate Synthase Domain Containing 2 (RPUSD2))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPUSD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RPUSD2 antibody was raised against the C terminal of RPUSD2

Aufreinigung: Affinity purified

Immunogen: RPUSD2 antibody was raised using the C terminal of RPUSD2 corresponding to a region with amino acids AEHQAKQSLDVLDLCEGDLSPGLTDSTAPSSELGKDDLEELAAAAQKMEE

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPUSD2 Blocking Peptide, catalog no. 33R-1132, is also available for use as a blocking control in assays to test for specificity of this RPUSD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPUSD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPUSD2

Target: RPUSD2 (RNA Pseudouridylate Synthase Domain Containing 2 (RPUSD2))

Andere Bezeichnung: RPUSD2 (RPUSD2 Produkte)

Synonyme: RPUSD2 antikoerper, C15orf19 antikoerper, C18B11 antikoerper, 4921503C21Rik antikoerper, 9630001E10 antikoerper, BB231107 antikoerper, RGD1306147 antikoerper, RNA pseudouridylate synthase domain containing 2 antikoerper, RPUSD2 antikoerper, Rpusd2 antikoerper

Hintergrund: RPUSD2 is involved in RNA binding and nucleotide binding.

Molekulargewicht: 61 kDa (MW of target protein)