RALYL Antikörper (C-Term)

Produktnummer ABIN633555

Produktdetails anti-RALYL Antikörper

Target: RALYL (RALY RNA Binding Protein-Like (RALYL))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RALYL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RALYL antibody was raised against the C terminal of RALYL

Aufreinigung: Affinity purified

Immunogen: RALYL antibody was raised using the C terminal of RALYL corresponding to a region with amino acids AQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFD

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RALYL Blocking Peptide, catalog no. 33R-1450, is also available for use as a blocking control in assays to test for specificity of this RALYL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALYL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RALYL

Target: RALYL (RALY RNA Binding Protein-Like (RALYL))

Andere Bezeichnung: RALYL (RALYL Produkte)

Synonyme: RGD1305844 antikoerper, RALYL antikoerper, LOC100225950 antikoerper, HNRPCL3 antikoerper, 0710005M24Rik antikoerper, RALY RNA binding protein-like antikoerper, RALY RNA binding protein like antikoerper, RNA-binding Raly-like protein antikoerper, Ralyl antikoerper, RALYL antikoerper, LOC100330501 antikoerper

Hintergrund: RALYL belongs to the RRM HNRPC family, RALY subfamily. It contains 1 RRM (RNA recognition motif) domain. The functions of RALYL remain unknown.

Molekulargewicht: 32 kDa (MW of target protein)