NSUN6 Antikörper (N-Term)
-
- Target Alle NSUN6 Antikörper anzeigen
- NSUN6 (NOP2/Sun Domain Family, Member 6 (NSUN6))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NSUN6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NSUN6 antibody was raised against the N terminal of NSUN6
- Aufreinigung
- Affinity purified
- Immunogen
- NSUN6 antibody was raised using the N terminal of NSUN6 corresponding to a region with amino acids SIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPPS
- Top Product
- Discover our top product NSUN6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NSUN6 Blocking Peptide, catalog no. 33R-8525, is also available for use as a blocking control in assays to test for specificity of this NSUN6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSUN6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NSUN6 (NOP2/Sun Domain Family, Member 6 (NSUN6))
- Andere Bezeichnung
- NSUN6 (NSUN6 Produkte)
- Synonyme
- 4933403D21Rik antikoerper, 4933414E04Rik antikoerper, NOPD1 antikoerper, Nopd1 antikoerper, putative methyltransferase NSUN6 antikoerper, NOL1/NOP2/Sun domain family member 6 antikoerper, NOP2/Sun RNA methyltransferase family member 6 antikoerper, NOP2/Sun domain family, member 6 antikoerper, Tsp_01405 antikoerper, Nsun6 antikoerper, NSUN6 antikoerper
- Hintergrund
- NSUN6 may have S-adenosyl-L-methionine-dependent methyl-transferase activity (Potential). NSUN6 belongs to the methyltransferase superfamily, RsmB/NOP family. It contains 1 PUA domain.
- Molekulargewicht
- 52 kDa (MW of target protein)
-