NSUN6 Antikörper (N-Term)

Produktnummer ABIN633558

Produktdetails anti-NSUN6 Antikörper

Target: NSUN6 (NOP2/Sun Domain Family, Member 6 (NSUN6))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NSUN6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NSUN6 antibody was raised against the N terminal of NSUN6

Aufreinigung: Affinity purified

Immunogen: NSUN6 antibody was raised using the N terminal of NSUN6 corresponding to a region with amino acids MSIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPP

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NSUN6 Blocking Peptide, catalog no. 33R-6444, is also available for use as a blocking control in assays to test for specificity of this NSUN6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSUN6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NSUN6

Target: NSUN6 (NOP2/Sun Domain Family, Member 6 (NSUN6))

Andere Bezeichnung: NSUN6 (NSUN6 Produkte)

Synonyme: 4933403D21Rik antikoerper, 4933414E04Rik antikoerper, NOPD1 antikoerper, Nopd1 antikoerper, putative methyltransferase NSUN6 antikoerper, NOL1/NOP2/Sun domain family member 6 antikoerper, NOP2/Sun RNA methyltransferase family member 6 antikoerper, NOP2/Sun domain family, member 6 antikoerper, Tsp_01405 antikoerper, Nsun6 antikoerper, NSUN6 antikoerper

Hintergrund: NSUN6 may have S-adenosyl-L-methionine-dependent methyl-transferase activity (Potential). NSUN6 belongs to the methyltransferase superfamily, RsmB/NOP family. It contains 1 PUA domain.

Molekulargewicht: 52 kDa (MW of target protein)