RBPMS2 Antikörper (Middle Region)
-
- Target Alle RBPMS2 Antikörper anzeigen
- RBPMS2 (RNA Binding Protein with Multiple Splicing 2 (RBPMS2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RBPMS2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RBPMS2 antibody was raised against the middle region of RBPMS2
- Aufreinigung
- Affinity purified
- Immunogen
- RBPMS2 antibody was raised using the middle region of RBPMS2 corresponding to a region with amino acids ANTKMAKSKLMATPNPSNVHPALGAHFIARDPYDLMGAALIPASPEAWAP
- Top Product
- Discover our top product RBPMS2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RBPMS2 Blocking Peptide, catalog no. 33R-1410, is also available for use as a blocking control in assays to test for specificity of this RBPMS2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBPMS2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RBPMS2 (RNA Binding Protein with Multiple Splicing 2 (RBPMS2))
- Andere Bezeichnung
- RBPMS2 (RBPMS2 Produkte)
- Synonyme
- hermes antikoerper, RBPMS antikoerper, 2400008B06Rik antikoerper, AI316523 antikoerper, RGD1561222 antikoerper, rbpms2 antikoerper, zgc:55559 antikoerper, zgc:77170 antikoerper, RNA binding protein with multiple splicing 2 L homeolog antikoerper, RNA binding protein with multiple splicing 2 antikoerper, RNA binding protein with multiple splicing 2b antikoerper, rbpms2.L antikoerper, RBPMS2 antikoerper, Rbpms2 antikoerper, rbpms2b antikoerper
- Hintergrund
- RBPMS2 contains 1 RRM (RNA recognition motif) domain. The exact function of RBPMS2 remains unknown.
- Molekulargewicht
- 22 kDa (MW of target protein)
-