MBNL1 Antikörper
-
- Target Alle MBNL1 Antikörper anzeigen
- MBNL1 (Muscleblind-like Protein 1 (MBNL1))
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MBNL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Affinity purified
- Immunogen
- MBNL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGI
- Top Product
- Discover our top product MBNL1 Primärantikörper
-
anti-Muscleblind-like Protein 1 (MBNL1) (AA 1-382) antibody
MBNL1 Reaktivität: Human WB, ELISA, IF, IHC (p) Wirt: Maus Monoclonal 3E7 unconjugated
anti-Muscleblind-like Protein 1 (MBNL1) antibodyMBNL1 Reaktivität: Human, Ratte, Maus WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Muscleblind-like Protein 1 (MBNL1) (AA 1-383) antibodyMBNL1 Reaktivität: Human WB, ELISA, IHC, IF, IHC (p) Wirt: Maus Monoclonal 3E7 unconjugated
anti-Muscleblind-like Protein 1 (MBNL1) (C-Term) antibodyMBNL1 Reaktivität: Human, Ratte WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Muscleblind-like Protein 1 (MBNL1) (Middle Region) antibodyMBNL1 Reaktivität: Human, Ratte, Maus, Hund, Pferd, Schwein, Kaninchen, Zebrafisch (Danio rerio) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Muscleblind-like Protein 1 (MBNL1) (AA 1-382) antibodyMBNL1 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Muscleblind-like Protein 1 (MBNL1) (AA 255-284), (C-Term) antibodyMBNL1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB42214 unconjugated
anti-Muscleblind-like Protein 1 (MBNL1) (AA 1-382) antibodyMBNL1 Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Muscleblind-like Protein 1 (MBNL1) antibodyMBNL1 Reaktivität: Human WB, IF Wirt: Kaninchen Monoclonal unconjugated
anti-Muscleblind-like Protein 1 (MBNL1) (AA 211-260) antibodyMBNL1 Reaktivität: Human, Ratte, Hund, Pferd, Schwein, Kaninchen, Zebrafisch (Danio rerio), Affe, Fledermaus, Huhn, Xenopus laevis WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 0.75 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MBNL1 Blocking Peptide, catalog no. 33R-1389, is also available for use as a blocking control in assays to test for specificity of this MBNL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBNL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MBNL1 (Muscleblind-like Protein 1 (MBNL1))
- Andere Bezeichnung
- MBNL1 (MBNL1 Produkte)
- Synonyme
- MBNL1 antikoerper, zgc:153954 antikoerper, Mbnl antikoerper, mKIAA0428 antikoerper, EXP antikoerper, EXP35 antikoerper, EXP40 antikoerper, EXP42 antikoerper, MBNL antikoerper, muscleblind like splicing regulator 1 antikoerper, muscleblind-like splicing regulator 1 antikoerper, muscleblind like splicing factor 1 antikoerper, MBNL1 antikoerper, mbnl1 antikoerper, Mbnl1 antikoerper
- Hintergrund
- MBNL1 contains 4 C3H1-type zinc fingers and binds to CUG triplet repeat expansion dsRNA.
- Molekulargewicht
- 38 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-
