IREB2 Antikörper (Middle Region)

Produktnummer ABIN633564

Produktdetails anti-IREB2 Antikörper

Target: IREB2 (Iron-Responsive Element Binding Protein 2 (IREB2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IREB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IREB2 antibody was raised against the middle region of IREB2

Aufreinigung: Affinity purified

Immunogen: IREB2 antibody was raised using the middle region of IREB2 corresponding to a region with amino acids IQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQIAAEK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IREB2 Blocking Peptide, catalog no. 33R-4113, is also available for use as a blocking control in assays to test for specificity of this IREB2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IREB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IREB2

Target: IREB2 (Iron-Responsive Element Binding Protein 2 (IREB2))

Andere Bezeichnung: IREB2 (IREB2 Produkte)

Synonyme: IREB2 antikoerper, im:7153062 antikoerper, DKFZp468N047 antikoerper, D9Ertd85e antikoerper, Irp2 antikoerper, ACO3 antikoerper, IRP2 antikoerper, IRP2AD antikoerper, IREBP2 antikoerper, iron responsive element binding protein 2 antikoerper, iron-responsive element binding protein 2 antikoerper, iron responsive element binding protein 2 L homeolog antikoerper, IREB2 antikoerper, ireb2 antikoerper, Ireb2 antikoerper, ireb2.L antikoerper

Hintergrund: IREB2 binds to iron-responsive elements (IRES), which are stem-loop structures found in the 5'-UTR of ferritin, and delta aminolevulinic acid synthase mRNAs, and in the 3'-UTR of transferrin receptor mRNA. IREB2 binds to the IRE element in ferritin which results in the repression of its mRNA translation. Binding of the protein to the transferrin receptor mRNA inhibits the degradation of this otherwise rapidly degraded mRNA.

Molekulargewicht: 105 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis