SNRPA1 Antikörper (Middle Region)
-
- Target Alle SNRPA1 (SNRPA) Antikörper anzeigen
- SNRPA1 (SNRPA) (Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SNRPA1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- SNRPA antibody was raised against the middle region of SNRPA
- Aufreinigung
- Affinity purified
- Immunogen
- SNRPA antibody was raised using the middle region of SNRPA corresponding to a region with amino acids MPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV
- Top Product
- Discover our top product SNRPA Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SNRPA Blocking Peptide, catalog no. 33R-6281, is also available for use as a blocking control in assays to test for specificity of this SNRPA antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SNRPA1 (SNRPA) (Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA))
- Andere Bezeichnung
- SNRPA (SNRPA Produkte)
- Synonyme
- Mud1 antikoerper, U1-A antikoerper, U1A antikoerper, im:7142962 antikoerper, zgc:101832 antikoerper, C430021M15Rik antikoerper, Rnu1a-1 antikoerper, Rnu1a1 antikoerper, mud1 antikoerper, snf antikoerper, fc19d01 antikoerper, wu:fc19d01 antikoerper, zgc:77810 antikoerper, T30B22.12 antikoerper, U1SNRNP-SPECIFIC PROTEIN antikoerper, spliceosomal protein U1A antikoerper, small nuclear ribonucleoprotein polypeptide A antikoerper, small nuclear ribonucleoprotein polypeptide A' antikoerper, small nuclear ribonucleoprotein polypeptide A S homeolog antikoerper, spliceosomal protein U1A antikoerper, SNRPA antikoerper, snrpa1 antikoerper, Snrpa antikoerper, snrpa.S antikoerper, snrpa antikoerper, U1A antikoerper
- Hintergrund
- SNRPA binds stem loop II of U1 snRNA. It is the first snRNP to interact with pre-mRNA. This interaction is required for the subsequent binding of U2 snRNP and the U4/U6/U5 tri-snRNP. In a snRNP-free form (SF-A) may be involved in coupled pre-mRNA splicing and polyadenylation process.
- Molekulargewicht
- 31 kDa (MW of target protein)
-