Aconitase 1 Antikörper (N-Term)

Produktnummer ABIN633567

Produktdetails anti-Aconitase 1 Antikörper

Target: Aconitase 1 (ACO1)

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Aconitase 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: ACO1 antibody was raised against the N terminal of ACO1

Aufreinigung: Affinity purified

Immunogen: ACO1 antibody was raised using the N terminal of ACO1 corresponding to a region with amino acids MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 12 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACO1 Blocking Peptide, catalog no. 33R-6475, is also available for use as a blocking control in assays to test for specificity of this ACO1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACO1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Aconitase 1

Target: Aconitase 1 (ACO1)

Andere Bezeichnung: ACO1 (ACO1 Produkte)

Synonyme: ACONS antikoerper, IREB1 antikoerper, IREBP antikoerper, IREBP1 antikoerper, IRP1 antikoerper, Acon1 antikoerper, Ratireb antikoerper, ratireb antikoerper, Aco1 antikoerper, AI256519 antikoerper, Aco-1 antikoerper, Irebp antikoerper, Irp1 antikoerper, aconitase 1 antikoerper, aconitase 1, soluble antikoerper, aconitase 1 L homeolog antikoerper, ACO1 antikoerper, Aco1 antikoerper, aco1.L antikoerper

Hintergrund: ACO1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). It plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.

Molekulargewicht: 98 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis