Aconitase 1 Antikörper (N-Term)
-
- Target Alle Aconitase 1 (ACO1) Antikörper anzeigen
- Aconitase 1 (ACO1)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Aconitase 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- ACO1 antibody was raised against the N terminal of ACO1
- Aufreinigung
- Affinity purified
- Immunogen
- ACO1 antibody was raised using the N terminal of ACO1 corresponding to a region with amino acids MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC
- Top Product
- Discover our top product ACO1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL, IHC: 12 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACO1 Blocking Peptide, catalog no. 33R-6475, is also available for use as a blocking control in assays to test for specificity of this ACO1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACO1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Aconitase 1 (ACO1)
- Andere Bezeichnung
- ACO1 (ACO1 Produkte)
- Hintergrund
- ACO1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). It plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.
- Molekulargewicht
- 98 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-