HNRNPM Antikörper (N-Term)
-
- Target Alle HNRNPM Antikörper anzeigen
- HNRNPM (Heterogeneous Nuclear Ribonucleoprotein M (HNRNPM))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HNRNPM Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HNRPM antibody was raised against the N terminal Of Hnrpm
- Aufreinigung
- Affinity purified
- Immunogen
- HNRPM antibody was raised using the N terminal Of Hnrpm corresponding to a region with amino acids ATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFE
- Top Product
- Discover our top product HNRNPM Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HNRPM Blocking Peptide, catalog no. 33R-1554, is also available for use as a blocking control in assays to test for specificity of this HNRPM antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPM antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HNRNPM (Heterogeneous Nuclear Ribonucleoprotein M (HNRNPM))
- Andere Bezeichnung
- HNRPM (HNRNPM Produkte)
- Synonyme
- HNRPM antikoerper, si:ch211-197g15.1 antikoerper, wu:fa10g07 antikoerper, wu:fa98b02 antikoerper, hnrpm antikoerper, CG9373 antikoerper, Dmel\\CG9373 antikoerper, Hrp59 antikoerper, cg9373 antikoerper, hnRNP M antikoerper, hrp59 antikoerper, p75 antikoerper, CEAR antikoerper, HNRNPM4 antikoerper, HNRPM4 antikoerper, HTGR1 antikoerper, NAGR1 antikoerper, 2610023M21Rik antikoerper, AA409009 antikoerper, Hnrpm antikoerper, mKIAA4193 antikoerper, Hnrpm4 antikoerper, heterogeneous nuclear ribonucleoprotein M antikoerper, Heterogeneous nuclear ribonucleoprotein M antikoerper, rumpelstiltskin antikoerper, HNRNPM antikoerper, hnrnpm antikoerper, hnrpm antikoerper, rump antikoerper, Hnrnpm antikoerper
- Hintergrund
- HNRPM belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.
- Molekulargewicht
- 73 kDa (MW of target protein)
-