CARS Antikörper (C-Term)

Produktnummer ABIN633577

Produktdetails anti-CARS Antikörper

Target: CARS (Cysteinyl-tRNA Synthetase (CARS))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CARS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: CARS antibody was raised against the C terminal of CARS

Aufreinigung: Affinity purified

Immunogen: CARS antibody was raised using the C terminal of CARS corresponding to a region with amino acids KRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHD

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CARS Blocking Peptide, catalog no. 33R-4626, is also available for use as a blocking control in assays to test for specificity of this CARS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CARS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CARS

Target: CARS (Cysteinyl-tRNA Synthetase (CARS))

Andere Bezeichnung: CARS (CARS Produkte)

Synonyme: sb:cb71 antikoerper, CARS antikoerper, BcDNA:LD21177 antikoerper, CG8431 antikoerper, CRS antikoerper, CysRS antikoerper, Dmel\\CG8431 antikoerper, BA0089 antikoerper, DDBDRAFT_0215191 antikoerper, DDBDRAFT_0231320 antikoerper, DDB_0215191 antikoerper, DDB_0231320 antikoerper, DDBDRAFT_0187313 antikoerper, DDBDRAFT_0231318 antikoerper, DDB_0187313 antikoerper, DDB_0231318 antikoerper, T16B12.16 antikoerper, K15E6.3 antikoerper, K15E6_3 antikoerper, CARS1 antikoerper, CYSRS antikoerper, MGC:11246 antikoerper, CA3 antikoerper, cysteinyl-tRNA synthetase antikoerper, Cysteinyl-tRNA synthetase antikoerper, cysteine--tRNA ligase antikoerper, cysteine-tRNA ligase antikoerper, Cysteinyl-tRNA synthetase, class Ia family protein antikoerper, cysteinyl-tRNA synthetase CysS antikoerper, cysteinyl-tRNA synthetase S homeolog antikoerper, CARS antikoerper, cars antikoerper, CysRS antikoerper, cysS antikoerper, APH_RS02395 antikoerper, mcysS antikoerper, SYCO ARATH antikoerper, AT3G56300 antikoerper, AT5G38830 antikoerper, cars.S antikoerper, Cars antikoerper

Hintergrund: CARS is a class 1 aminoacyl-tRNA synthetase, cysteinyl-tRNA synthetase. Each of the twenty aminoacyl-tRNA synthetases catalyzes the aminoacylation of a specific tRNA or tRNA isoaccepting family with the cognate amino acid. This gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer.

Molekulargewicht: 81 kDa (MW of target protein)