RPL18 Antikörper (N-Term)

Produktnummer ABIN633580

Produktdetails anti-RPL18 Antikörper

Target: RPL18 (Ribosomal Protein L18 (RPL18))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPL18 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RPL18 antibody was raised against the N terminal of RPL18

Aufreinigung: Affinity purified

Immunogen: RPL18 antibody was raised using the N terminal of RPL18 corresponding to a region with amino acids MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPL18 Blocking Peptide, catalog no. 33R-6085, is also available for use as a blocking control in assays to test for specificity of this RPL18 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL18 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPL18

Target: RPL18 (Ribosomal Protein L18 (RPL18))

Andere Bezeichnung: RPL18 (RPL18 Produkte)

Synonyme: L18 antikoerper, Rpl18a antikoerper, fa98d03 antikoerper, wu:fa98d03 antikoerper, zgc:92872 antikoerper, rpl14a antikoerper, rpl18 antikoerper, CG8615 antikoerper, Dmel\\CG8615 antikoerper, Rp L18 antikoerper, RpL18e antikoerper, ribosomal protein L18 antikoerper, 60S ribosomal protein L18 antikoerper, ribosomal protein L18 S homeolog antikoerper, 50S ribosomal protein L18 antikoerper, Ribosomal protein L18 antikoerper, RPL18 antikoerper, Rpl18 antikoerper, rpl-18 antikoerper, rpl18 antikoerper, rpl18.S antikoerper, RpL18 antikoerper

Hintergrund: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L18E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Molekulargewicht: 22 kDa (MW of target protein)