NOP56 Antikörper
-
- Target Alle NOP56 Antikörper anzeigen
- NOP56 (NOP56 Ribonucleoprotein Homolog (NOP56))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NOP56 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- NOL5 A antibody was raised using a synthetic peptide corresponding to a region with amino acids EERLSFYETGEIPRKNLDVMKEAMVQAEEAAAEITRKLEKQEKKRLKKKK
- Top Product
- Discover our top product NOP56 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NOL5A Blocking Peptide, catalog no. 33R-2386, is also available for use as a blocking control in assays to test for specificity of this NOL5A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOL0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NOP56 (NOP56 Ribonucleoprotein Homolog (NOP56))
- Andere Bezeichnung
- NOL5A (NOP56 Produkte)
- Synonyme
- An16g03090 antikoerper, AO090005001291 antikoerper, NOL5A antikoerper, SCA36 antikoerper, 2310044F10Rik antikoerper, Nol5a antikoerper, nol5a antikoerper, nucleolar protein 56 antikoerper, NOP56 ribonucleoprotein antikoerper, NOP56 ribonucleoprotein homolog antikoerper, ANI_1_440144 antikoerper, AOR_1_2236174 antikoerper, NOP56 antikoerper, Nop56 antikoerper, nop56 antikoerper
- Hintergrund
- Nop56p is a yeast nucleolar protein that is part of a complex with the nucleolar proteins Nop58p and fibrillarin. Nop56p is required for assembly of the 60S ribosomal subunit and is involved in pre-rRNA processing. NOL5A is similar in sequence to Nop56p and is also found in the nucleolus. Multiple transcript variants encoding several different isoforms have been found for this gene, but the full-length nature of most of them have not been determined.
- Molekulargewicht
- 48 kDa (MW of target protein)
-