STAU1/Staufen Antikörper
-
- Target Alle STAU1/Staufen (STAU1) Antikörper anzeigen
- STAU1/Staufen (STAU1) (Staufen Double-Stranded RNA Binding Protein 1 (STAU1))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser STAU1/Staufen Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- STAU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NFEVARESGPPHMKNFVTKVSVGEFVGEGEGKSKKISKKNAAIAVLEELK
- Top Product
- Discover our top product STAU1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
STAU1 Blocking Peptide, catalog no. 33R-6681, is also available for use as a blocking control in assays to test for specificity of this STAU1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STAU1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- STAU1/Staufen (STAU1) (Staufen Double-Stranded RNA Binding Protein 1 (STAU1))
- Andere Bezeichnung
- STAU1 (STAU1 Produkte)
- Synonyme
- STAU1 antikoerper, DKFZp459A0124 antikoerper, CG5753 antikoerper, Dmel\\CG5753 antikoerper, Dmstau antikoerper, STAU antikoerper, Stau antikoerper, Stauf antikoerper, dStau antikoerper, stau antikoerper, XStau antikoerper, XStau1 antikoerper, Staufen antikoerper, Staufen1 antikoerper, MGC145034 antikoerper, 5830401L18Rik antikoerper, AW549911 antikoerper, C85792 antikoerper, fi67e05 antikoerper, wu:fi67e05 antikoerper, zgc:77271 antikoerper, staufen double-stranded RNA binding protein 1 antikoerper, staufen antikoerper, RNA binding protein homolog antikoerper, staufen (RNA binding protein) homolog 1 (Drosophila) antikoerper, staufen double-stranded RNA binding protein 1 L homeolog antikoerper, STAU1 antikoerper, stau antikoerper, stau1 antikoerper, STAUFEN antikoerper, Stau1 antikoerper, stau1.L antikoerper
- Hintergrund
- STAU1(Staufen) is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures.
- Molekulargewicht
- 35 kDa (MW of target protein)
- Pathways
- Asymmetric Protein Localization
-