EIF4E3 Antikörper (Middle Region)
-
- Target Alle EIF4E3 Antikörper anzeigen
- EIF4E3 (Eukaryotic Translation Initiation Factor 4E Family Member 3 (EIF4E3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EIF4E3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EIF4 E3 antibody was raised against the middle region of EIF4 3
- Aufreinigung
- Affinity purified
- Immunogen
- EIF4 E3 antibody was raised using the middle region of EIF4 3 corresponding to a region with amino acids VQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHHAFEGGRGKH
- Top Product
- Discover our top product EIF4E3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EIF4E3 Blocking Peptide, catalog no. 33R-9766, is also available for use as a blocking control in assays to test for specificity of this EIF4E3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EIF4E3 (Eukaryotic Translation Initiation Factor 4E Family Member 3 (EIF4E3))
- Andere Bezeichnung
- EIF4E3 (EIF4E3 Produkte)
- Synonyme
- eif4e3 antikoerper, wu:fc31f11 antikoerper, wu:fd15f11 antikoerper, zgc:92189 antikoerper, DDBDRAFT_0191035 antikoerper, DDBDRAFT_0234256 antikoerper, DDB_0191035 antikoerper, DDB_0234256 antikoerper, IF4E3 antikoerper, 1300018P11Rik antikoerper, AI451927 antikoerper, eIF4E-3 antikoerper, eukaryotic translation initiation factor 4E family member 3 antikoerper, eukaryotic translation initiation factor 4E family member 3 L homeolog antikoerper, eukaryotic translation initiation factor 4E member 3 antikoerper, eukaryotic translation initiation factor 4E family member 3 S homeolog antikoerper, EIF4E3 antikoerper, Eif4e3 antikoerper, eif4e3.L antikoerper, eif4e3 antikoerper, eIF4e3 antikoerper, eif4e3.S antikoerper
- Hintergrund
- EIF4E3 belongs to the EIF4E family of translational initiation factors that interact with the 5-prime cap structure of mRNA and recruit mRNA to the ribosome.
- Molekulargewicht
- 24 kDa (MW of target protein)
-