SFRS7 Antikörper (N-Term)

Produktnummer ABIN633590

Produktdetails anti-SFRS7 Antikörper

Target: SFRS7 (Splicing Factor, Arginine/Serine Rich 7 (SFRS7))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SFRS7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SFRS7 antibody was raised against the N terminal of SFRS7

Aufreinigung: Affinity purified

Immunogen: SFRS7 antibody was raised using the N terminal of SFRS7 corresponding to a region with amino acids MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SFRS7 Blocking Peptide, catalog no. 33R-6493, is also available for use as a blocking control in assays to test for specificity of this SFRS7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SFRS7

Target: SFRS7 (Splicing Factor, Arginine/Serine Rich 7 (SFRS7))

Andere Bezeichnung: SFRS7 (SFRS7 Produkte)

Synonyme: 9G8 antikoerper, AAG3 antikoerper, SFRS7 antikoerper, 35kDa antikoerper, 9430065L19Rik antikoerper, NX-96 antikoerper, Sfrs7 antikoerper, 9g8 antikoerper, aag3 antikoerper, sfrs7 antikoerper, srsf7 antikoerper, zgc:114203 antikoerper, serine and arginine rich splicing factor 7 antikoerper, serine/arginine-rich splicing factor 7 antikoerper, serine/arginine-rich splicing factor 7 L homeolog antikoerper, serine/arginine-rich splicing factor 7b antikoerper, SRSF7 antikoerper, Srsf7 antikoerper, srsf7.L antikoerper, srsf7b antikoerper

Hintergrund: SFRS7 is required for pre-mRNA splicing. SFRS7 can also modulate alternative splicing in vitro.

Molekulargewicht: 27 kDa (MW of target protein)