BAT1 Antikörper (C-Term)

Produktnummer ABIN633592

Produktdetails anti-BAT1 Antikörper

Target: BAT1 (DDX39) (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 39 (DDX39))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte, Hund, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BAT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BAT1 antibody was raised against the C terminal of BAT1

Aufreinigung: Affinity purified

Immunogen: BAT1 antibody was raised using the C terminal of BAT1 corresponding to a region with amino acids YDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNI

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BAT1 Blocking Peptide, catalog no. 33R-10073, is also available for use as a blocking control in assays to test for specificity of this BAT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BAT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BAT1

Target: BAT1 (DDX39) (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 39 (DDX39))

Andere Bezeichnung: BAT1 (DDX39 Produkte)

Hintergrund: BAT1 is a member of the DEAD protein family of ATP-dependent RNA helicases. Members of this family are involved in a number of cellular functions including initiation of translation, RNA splicing, and ribosome assembly. A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization