BAT1 Antikörper (N-Term)

Produktnummer ABIN633595

Produktdetails anti-BAT1 Antikörper

Target: BAT1 (DDX39) (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 39 (DDX39))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BAT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BAT1 antibody was raised against the N terminal of BAT1

Aufreinigung: Affinity purified

Immunogen: BAT1 antibody was raised using the N terminal of BAT1 corresponding to a region with amino acids MAENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BAT1 Blocking Peptide, catalog no. 33R-5641, is also available for use as a blocking control in assays to test for specificity of this BAT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BAT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BAT1

Target: BAT1 (DDX39) (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 39 (DDX39))

Andere Bezeichnung: BAT1 (DDX39 Produkte)

Synonyme: dxd39 antikoerper, MGC53693 antikoerper, MGC130793 antikoerper, ddx39 antikoerper, MGC53944 antikoerper, DDX39 antikoerper, 2610307C23Rik antikoerper, BAT1 antikoerper, DDXL antikoerper, Ddx39a antikoerper, URH49 antikoerper, bat1 antikoerper, uap56 antikoerper, D6S81E antikoerper, UAP56 antikoerper, Bat1 antikoerper, Bat1a antikoerper, p47 antikoerper, DEAD-box helicase 39A S homeolog antikoerper, nuclear RNA helicase antikoerper, DExD-box helicase 39A antikoerper, DEAD-box helicase 39A antikoerper, ATP-dependent RNA helicase DDX39 antikoerper, ATP-dependent RNA helicase DDX39A antikoerper, DEAD (Asp-Glu-Ala-Asp) box polypeptide 39b antikoerper, DEAD (Asp-Glu-Ala-Asp) box polypeptide 39 antikoerper, DEAD-box helicase 39B L homeolog antikoerper, DExD-box helicase 39B antikoerper, ddx39a.S antikoerper, ddx39 antikoerper, DDX39A antikoerper, ddx39a antikoerper, LOC100084960 antikoerper, ddx39b antikoerper, Ddx39 antikoerper, ddx39b.L antikoerper, DDX39B antikoerper, Ddx39b antikoerper

Hintergrund: BAT1 is a member of the DEAD protein family of ATP-dependent RNA helicases. Members of this family are involved in a number of cellular functions including initiation of translation, RNA splicing, and ribosome assembly.

Molekulargewicht: 49 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization