AKAP1 Antikörper

Produktnummer ABIN633600

Produktdetails anti-AKAP1 Antikörper

Target: AKAP1 (A Kinase (PRKA) Anchor Protein 1 (AKAP1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AKAP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: AKAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPFSNGVLKGELSDLGAEDGWTMDAEADHSGVAAPPPGKRGTLITRCPGF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AKAP1 Blocking Peptide, catalog no. 33R-9725, is also available for use as a blocking control in assays to test for specificity of this AKAP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKAP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AKAP1

Target: AKAP1 (A Kinase (PRKA) Anchor Protein 1 (AKAP1))

Andere Bezeichnung: AKAP1 (AKAP1 Produkte)

Synonyme: AKAP1 antikoerper, akap1 antikoerper, fa08b04 antikoerper, wu:fa08b04 antikoerper, AKAP antikoerper, AKAP121 antikoerper, AKAP149 antikoerper, AKAP84 antikoerper, D-AKAP1 antikoerper, PPP1R43 antikoerper, PRKA1 antikoerper, SAKAP84 antikoerper, TDRD17 antikoerper, Akap antikoerper, C76494 antikoerper, C81186 antikoerper, DAKAP1 antikoerper, S-AKAP84 antikoerper, Akap84 antikoerper, A-kinase anchoring protein 1 antikoerper, A kinase (PRKA) anchor protein 1b antikoerper, A kinase (PRKA) anchor protein 1 antikoerper, AKAP1 antikoerper, akap1b antikoerper, akap1 antikoerper, Akap1 antikoerper

Hintergrund: The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell.

Molekulargewicht: 65 kDa (MW of target protein)

Pathways: Synaptic Membrane