RBM12 Antikörper (N-Term)
-
- Target Alle RBM12 Antikörper anzeigen
- RBM12 (RNA Binding Motif Protein 12 (RBM12))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RBM12 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RBM12 antibody was raised against the N terminal of RBM12
- Aufreinigung
- Affinity purified
- Immunogen
- RBM12 antibody was raised using the N terminal of RBM12 corresponding to a region with amino acids PPPSSGMSSRVNLPTTVSNFNNPSPSVVTATTSVHESNKNIQTFSTASVG
- Top Product
- Discover our top product RBM12 Primärantikörper
-
anti-RNA Binding Motif Protein 12 (RBM12) (AA 1-200) antibody
RBM12 Reaktivität: Human ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-RNA Binding Motif Protein 12 (RBM12) (AA 834-932) antibodyRBM12 Reaktivität: Human ELISA, WB Wirt: Maus Monoclonal 1D12 unconjugated
anti-RNA Binding Motif Protein 12 (RBM12) (AA 575-603) antibodyRBM12 Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-RNA Binding Motif Protein 12 (RBM12) antibodyRBM12 Reaktivität: Human, Maus ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-RNA Binding Motif Protein 12 (RBM12) (C-Term) antibodyRBM12 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-RNA Binding Motif Protein 12 (RBM12) (AA 107-156) antibodyRBM12 Reaktivität: Human, Maus, Meerschweinchen, Affe, Fledermaus WB Wirt: Kaninchen Polyclonal unconjugated
anti-RNA Binding Motif Protein 12 (RBM12) (AA 576-625) antibodyRBM12 Reaktivität: Human, Maus, Rind (Kuh), Ratte, Hund, Schwein, Kaninchen, Meerschweinchen, Affe, Fledermaus WB Wirt: Kaninchen Polyclonal unconjugated
anti-RNA Binding Motif Protein 12 (RBM12) (N-Term) antibodyRBM12 Reaktivität: Human, Maus, Rind (Kuh), Ratte, Hund, Pferd, Schwein, Kaninchen, Meerschweinchen WB Wirt: Kaninchen Polyclonal unconjugated
anti-RNA Binding Motif Protein 12 (RBM12) (AA 574-603), (Middle Region) antibodyRBM12 Reaktivität: Human, Maus WB, EIA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RBM12 Blocking Peptide, catalog no. 33R-7271, is also available for use as a blocking control in assays to test for specificity of this RBM12 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM12 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RBM12 (RNA Binding Motif Protein 12 (RBM12))
- Andere Bezeichnung
- RBM12 (RBM12 Produkte)
- Synonyme
- HRIHFB2091 antikoerper, SWAN antikoerper, 5730420G12Rik antikoerper, 9430070C08Rik antikoerper, AI852903 antikoerper, mKIAA0765 antikoerper, zgc:193560 antikoerper, zgc:193570 antikoerper, MGC68861 antikoerper, hrihfb2091 antikoerper, DKFZp469A078 antikoerper, RNA binding motif protein 12 antikoerper, RNA binding motif protein 12 L homeolog antikoerper, RBM12 antikoerper, Rbm12 antikoerper, rbm12.L antikoerper, rbm12 antikoerper, LOC733876 antikoerper
- Hintergrund
- RBM12 contains several RNA-binding motifs, potential transmembrane domains, and proline-rich regions. The function of RBM12 remains unknown.
- Molekulargewicht
- 97 kDa (MW of target protein)
-
