SMNDC1 Antikörper (C-Term)

Produktnummer ABIN633607

Produktdetails anti-SMNDC1 Antikörper

Target: SMNDC1 (Survival Motor Neuron Domain Containing 1 (SMNDC1))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SMNDC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SMNDC1 antibody was raised against the C terminal of SMNDC1

Aufreinigung: Affinity purified

Immunogen: SMNDC1 antibody was raised using the C terminal of SMNDC1 corresponding to a region with amino acids KGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SMNDC1 Blocking Peptide, catalog no. 33R-4403, is also available for use as a blocking control in assays to test for specificity of this SMNDC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMNDC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SMNDC1

Target: SMNDC1 (Survival Motor Neuron Domain Containing 1 (SMNDC1))

Andere Bezeichnung: SMNDC1 (SMNDC1 Produkte)

Synonyme: smnr antikoerper, spf30 antikoerper, SMNDC1 antikoerper, SMNR antikoerper, SPF30 antikoerper, TDRD16C antikoerper, wu:fb37h07 antikoerper, wu:fc23a07 antikoerper, 2410004J23Rik antikoerper, 4933440I19Rik antikoerper, survival motor neuron domain containing 1 antikoerper, smndc1 antikoerper, SMNDC1 antikoerper, Bm1_41545 antikoerper, Smndc1 antikoerper

Hintergrund: This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy. SMNDC1 is a nuclear protein that has been identified as a constituent of the spliceosome complex. This gene is differentially expressed, with abundant levels in skeletal muscle, and may share similar cellular function as the SMN1 gene. This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy.

Molekulargewicht: 27 kDa (MW of target protein)