KCTD15 Antikörper (N-Term)

Produktnummer ABIN633619

Produktdetails anti-KCTD15 Antikörper

Target: KCTD15 (Potassium Channel Tetramerisation Domain Containing 15 (KCTD15))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCTD15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCTD15 antibody was raised against the N terminal of KCTD15

Aufreinigung: Affinity purified

Immunogen: KCTD15 antibody was raised using the N terminal of KCTD15 corresponding to a region with amino acids PVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPDSRISRL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCTD15 Blocking Peptide, catalog no. 33R-7424, is also available for use as a blocking control in assays to test for specificity of this KCTD15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCTD15

Target: KCTD15 (Potassium Channel Tetramerisation Domain Containing 15 (KCTD15))

Andere Bezeichnung: KCTD15 (KCTD15 Produkte)

Synonyme: BC031749 antikoerper, kctd15 antikoerper, zgc:100865 antikoerper, fa02e12 antikoerper, kctd15l antikoerper, wu:fa02e12 antikoerper, zgc:103747 antikoerper, potassium channel tetramerization domain containing 15 antikoerper, potassium channel tetramerisation domain containing 15 antikoerper, potassium channel tetramerization domain containing 15 L homeolog antikoerper, potassium channel tetramerization domain containing 15b antikoerper, potassium channel tetramerization domain containing 15a antikoerper, KCTD15 antikoerper, Kctd15 antikoerper, kctd15.L antikoerper, kctd15b antikoerper, kctd15a antikoerper

Hintergrund: KCTD15 contains 1 BTB (POZ) domain. The exact function of KCTD15 is not known.

Molekulargewicht: 26 kDa (MW of target protein)