TOMM40L Antikörper
-
- Target Alle TOMM40L Antikörper anzeigen
- TOMM40L (Translocase of Outer Mitochondrial Membrane 40 Like (TOMM40L))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TOMM40L Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- TOMM40 L antibody was raised using a synthetic peptide corresponding to a region with amino acids LNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGEYRGDDYTATLTLGNPD
- Top Product
- Discover our top product TOMM40L Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TOMM40L Blocking Peptide, catalog no. 33R-5217, is also available for use as a blocking control in assays to test for specificity of this TOMM40L antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOMM40 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TOMM40L (Translocase of Outer Mitochondrial Membrane 40 Like (TOMM40L))
- Andere Bezeichnung
- TOMM40L (TOMM40L Produkte)
- Hintergrund
- TOMM40L is a potential channel-forming protein implicated in import of protein precursors into mitochondria.
- Molekulargewicht
- 34 kDa (MW of target protein)
-