CLCNKB Antikörper (N-Term)
-
- Target Alle CLCNKB Antikörper anzeigen
- CLCNKB (Chloride Channel Kb (CLCNKB))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CLCNKB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CLCNKB antibody was raised against the N terminal of CLCNKB
- Aufreinigung
- Affinity purified
- Immunogen
- CLCNKB antibody was raised using the N terminal of CLCNKB corresponding to a region with amino acids MEEFVGLREGSSGNPVTLQELWGPCPRIRRGIRGGLEWLKQKLFRLGEDW
- Top Product
- Discover our top product CLCNKB Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CLCNKB Blocking Peptide, catalog no. 33R-5901, is also available for use as a blocking control in assays to test for specificity of this CLCNKB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLCNKB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CLCNKB (Chloride Channel Kb (CLCNKB))
- Andere Bezeichnung
- CLCNKB (CLCNKB Produkte)
- Hintergrund
- Chloride channel Kb (CLCNKB) is a member of the CLC family of voltage-gated chloride channels, which comprises at least 9 mammalian chloride channels. Each is believed to have 12 transmembrane domains and intracellular N and C termini. Mutations in CLCNKB result in the autosomal recessive Type III Bartter Syndrome. CLCNKA and CLCNKB are closely related (94% sequence identity), tightly linked (separated by 11 kb of genomic sequence) and are both expressed in mammalian kidney.
- Molekulargewicht
- 50 kDa (MW of target protein)
-