CATSPER2 Antikörper (N-Term)
-
- Target Alle CATSPER2 Antikörper anzeigen
- CATSPER2 (Cation Channel, Sperm Associated 2 (CATSPER2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CATSPER2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CATSPER2 antibody was raised against the N terminal of CATSPER2
- Aufreinigung
- Affinity purified
- Immunogen
- CATSPER2 antibody was raised using the N terminal of CATSPER2 corresponding to a region with amino acids HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA
- Top Product
- Discover our top product CATSPER2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CATSPER2 Blocking Peptide, catalog no. 33R-3783, is also available for use as a blocking control in assays to test for specificity of this CATSPER2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CATSPER2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CATSPER2 (Cation Channel, Sperm Associated 2 (CATSPER2))
- Andere Bezeichnung
- CATSPER2 (CATSPER2 Produkte)
- Synonyme
- CATSPER2 antikoerper, cation channel, sperm associated 2 antikoerper, cation channel sperm associated 2 antikoerper, CATSPER2 antikoerper, Catsper2 antikoerper
- Hintergrund
- Calcium ions play a primary role in the regulation of sperm motility. Anti-CATSPER2 belongs to a family of putative cation channels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeat with six membrane-spanning segments and a predicted calcium-selective pore region. A second, closely linked copy of this gene has been identified. Although multiple transcript variants encoding protein isoforms have been characterized, they seem to be only transcribed from this gene. Additional splice variants have been described but their full-length nature has not been determined.
- Molekulargewicht
- 46 kDa (MW of target protein)
-