SHROOM2 Antikörper (Middle Region)
-
- Target Alle SHROOM2 Antikörper anzeigen
- SHROOM2 (Shroom Family Member 2 (SHROOM2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SHROOM2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SHROOM2 antibody was raised against the middle region of SHROOM2
- Aufreinigung
- Affinity purified
- Immunogen
- SHROOM2 antibody was raised using the middle region of SHROOM2 corresponding to a region with amino acids CTSPPGLSYMKAKEKTVEDLKSEELAREIVGKDKSLADILDPSVKIKTTM
- Top Product
- Discover our top product SHROOM2 Primärantikörper
-
anti-Shroom Family Member 2 (SHROOM2) (C-Term) antibody
SHROOM2 Reaktivität: Human WB, IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Shroom Family Member 2 (SHROOM2) (AA 1554-1616) antibodySHROOM2 Reaktivität: Human WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Shroom Family Member 2 (SHROOM2) (AA 213-405) antibodySHROOM2 Reaktivität: Human ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Shroom Family Member 2 (SHROOM2) (AA 599-625) antibodySHROOM2 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB37634 unconjugated
anti-Shroom Family Member 2 (SHROOM2) (C-Term) antibodyVerified SHROOM2 Reaktivität: Human ELISA, IHC Wirt: Ziege Polyclonal unconjugated
anti-Shroom Family Member 2 (SHROOM2) (AA 1295-1344) antibodySHROOM2 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Huhn, Affe, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SHROOM2 Blocking Peptide, catalog no. 33R-1824, is also available for use as a blocking control in assays to test for specificity of this SHROOM2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHROOM2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SHROOM2 (Shroom Family Member 2 (SHROOM2))
- Andere Bezeichnung
- SHROOM2 (SHROOM2 Produkte)
- Synonyme
- SHROOM2 antikoerper, APXL antikoerper, apxl antikoerper, shrm2 antikoerper, HSAPXL antikoerper, 4832440C16 antikoerper, Apxl antikoerper, C630003H05Rik antikoerper, Shrm2 antikoerper, shroom family member 2 antikoerper, SHROOM2 antikoerper, shroom2 antikoerper, Shroom2 antikoerper
- Hintergrund
- SHROOM2 shares significant similarities with the apical protein from Xenopus laevis which is implicated in amiloride-sensitive sodium channel activity. This gene is a strong candidate gene for ocular albinism type 1 syndrome.
- Molekulargewicht
- 176 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization, Asymmetric Protein Localization
-
