KCTD7 Antikörper (N-Term)
-
- Target Alle KCTD7 Antikörper anzeigen
- KCTD7 (Potassium Channel Tetramerisation Domain Containing 7 (KCTD7))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCTD7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KCTD7 antibody was raised against the N terminal of KCTD7
- Aufreinigung
- Affinity purified
- Immunogen
- KCTD7 antibody was raised using the N terminal of KCTD7 corresponding to a region with amino acids VVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPE
- Top Product
- Discover our top product KCTD7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCTD7 Blocking Peptide, catalog no. 33R-9904, is also available for use as a blocking control in assays to test for specificity of this KCTD7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCTD7 (Potassium Channel Tetramerisation Domain Containing 7 (KCTD7))
- Andere Bezeichnung
- KCTD7 (KCTD7 Produkte)
- Synonyme
- 4932409E18 antikoerper, 9430010P06Rik antikoerper, zgc:136884 antikoerper, CLN14 antikoerper, EPM3 antikoerper, potassium channel tetramerization domain containing 7 antikoerper, potassium channel tetramerisation domain containing 7 antikoerper, KCTD7 antikoerper, Kctd7 antikoerper, kctd7 antikoerper
- Hintergrund
- The KCTD gene family, including KCTD7, encode predicted proteins that contain N-terminal domain that is homologous to the T1 domain in voltage-gated potassium channels. KCTD7 displays a primary sequence and hydropathy profile indicating intracytoplasmic localization. EST database analysis showed that KCTD7 is expressed in human and mouse brain.
- Molekulargewicht
- 33 kDa (MW of target protein)
-