KCTD13 Antikörper (N-Term)

Produktnummer ABIN633662

Produktdetails anti-KCTD13 Antikörper

Target: KCTD13 (Potassium Channel Tetramerisation Domain Containing 13 (KCTD13))

Bindungsspezifität: N-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCTD13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: KCTD13 antibody was raised against the N terminal of KCTD13

Aufreinigung: Affinity purified

Immunogen: KCTD13 antibody was raised using the N terminal of KCTD13 corresponding to a region with amino acids PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCTD13 Blocking Peptide, catalog no. 33R-7119, is also available for use as a blocking control in assays to test for specificity of this KCTD13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCTD13

Target: KCTD13 (Potassium Channel Tetramerisation Domain Containing 13 (KCTD13))

Andere Bezeichnung: KCTD13 (KCTD13 Produkte)

Hintergrund: KCTD13 mRNA is expressed in 3T3-L1 adipocytes and THP-1 macrophages. It is suggested that this gene provides a link between cytokine activation and DNA replication in liver as well as in other tissues.

Molekulargewicht: 36 kDa (MW of target protein)