KCTD13 Antikörper (N-Term)

Produktnummer ABIN633662

Produktdetails anti-KCTD13 Antikörper

Target: KCTD13 (Potassium Channel Tetramerisation Domain Containing 13 (KCTD13))

Bindungsspezifität: N-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCTD13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: KCTD13 antibody was raised against the N terminal of KCTD13

Aufreinigung: Affinity purified

Immunogen: KCTD13 antibody was raised using the N terminal of KCTD13 corresponding to a region with amino acids PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCTD13 Blocking Peptide, catalog no. 33R-7119, is also available for use as a blocking control in assays to test for specificity of this KCTD13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCTD13

Target: KCTD13 (Potassium Channel Tetramerisation Domain Containing 13 (KCTD13))

Andere Bezeichnung: KCTD13 (KCTD13 Produkte)

Synonyme: KCTD13 antikoerper, zgc:153421 antikoerper, 1500003N18Rik antikoerper, AV259508 antikoerper, PDIP1alpha antikoerper, Pdip1 antikoerper, Poldip1 antikoerper, PDIP1 antikoerper, POLDIP1 antikoerper, hBACURD1 antikoerper, potassium channel tetramerization domain containing 13 antikoerper, potassium channel tetramerisation domain containing 13 antikoerper, KCTD13 antikoerper, kctd13 antikoerper, Kctd13 antikoerper

Hintergrund: KCTD13 mRNA is expressed in 3T3-L1 adipocytes and THP-1 macrophages. It is suggested that this gene provides a link between cytokine activation and DNA replication in liver as well as in other tissues.

Molekulargewicht: 36 kDa (MW of target protein)