ACCN4 Antikörper (N-Term)

Produktnummer ABIN633663

Produktdetails anti-ACCN4 Antikörper

Target: ACCN4 (Amiloride-Sensitive Cation Channel 4, Pituitary (ACCN4))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACCN4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ACCN4 antibody was raised against the N terminal of ACCN4

Aufreinigung: Affinity purified

Immunogen: ACCN4 antibody was raised using the N terminal of ACCN4 corresponding to a region with amino acids SPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLA

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACCN4 Blocking Peptide, catalog no. 33R-8696, is also available for use as a blocking control in assays to test for specificity of this ACCN4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACCN4

Target: ACCN4 (Amiloride-Sensitive Cation Channel 4, Pituitary (ACCN4))

Andere Bezeichnung: ACCN4 (ACCN4 Produkte)

Synonyme: ACCN4 antikoerper, BNAC4 antikoerper, Accn4 antikoerper, Spasic antikoerper, acid sensing ion channel subunit family member 4 S homeolog antikoerper, acid sensing ion channel subunit family member 4 antikoerper, acid-sensing (proton-gated) ion channel family member 4 antikoerper, asic4.S antikoerper, ASIC4 antikoerper, Asic4 antikoerper

Hintergrund: ACCN4 belongs to the superfamily of acid-sensing ion channels, which are proton-gated, amiloride-sensitive sodium channels. These channels have been implicated in synaptic transmission, pain perception as well as mechanoperception. ACCN4 is predominantly expressed in the pituitary gland, and might be a candidate for paroxysmal dystonic choreoathetosis (PDC), a movement disorder.

Molekulargewicht: 46 kDa (MW of target protein)