KCTD4 Antikörper (N-Term)

Produktnummer ABIN633664

Produktdetails anti-KCTD4 Antikörper

Target: KCTD4 (BTB (POZ) Domain-Containing Protein KCTD4 (KCTD4))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCTD4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCTD4 antibody was raised against the N terminal of KCTD4

Aufreinigung: Affinity purified

Immunogen: KCTD4 antibody was raised using the N terminal of KCTD4 corresponding to a region with amino acids MTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCPFDADGHYFIDRDGL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCTD4 Blocking Peptide, catalog no. 33R-6554, is also available for use as a blocking control in assays to test for specificity of this KCTD4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCTD4

Target: KCTD4 (BTB (POZ) Domain-Containing Protein KCTD4 (KCTD4))

Andere Bezeichnung: KCTD4 (KCTD4 Produkte)

Synonyme: bA321C24.3 antikoerper, 2210017A09Rik antikoerper, AU017169 antikoerper, wu:fk37b10 antikoerper, zgc:92463 antikoerper, potassium channel tetramerization domain containing 4 antikoerper, potassium channel tetramerisation domain containing 4 antikoerper, KCTD4 antikoerper, Kctd4 antikoerper, kctd4 antikoerper

Hintergrund: KCTD4 contains 1 BTB (POZ) domain. The exact function of KCTD4 remains unknown.

Molekulargewicht: 30 kDa (MW of target protein)